DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and HSPB7

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001336611.1 Gene:HSPB7 / 27129 HGNCID:5249 Length:245 Species:Homo sapiens


Alignment Length:120 Identity:42/120 - (35%)
Similarity:62/120 - (51%) Gaps:11/120 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YLRPWHTNSLQ-KQESGSTLNIDS--EKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEH 115
            ::|| |:..|. ....|...||.:  :.:|..:||:.|||.:|.|..::..:.|..   ||....
Human   130 FMRP-HSEPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRA---EKLAAD 190

  Fly   116 GYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQITQT 170
            |.|...|:.:.|||.||:|.:|||:|..||.|||:|...    |.||.:.|..:|
Human   191 GTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRARRH----PHTEHVQQTFRT 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 32/83 (39%)
HSPB7NP_001336611.1 ACD_HspB7_like 148..228 CDD:107234 32/82 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148926
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.