DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and HSPB8

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_055180.1 Gene:HSPB8 / 26353 HGNCID:30171 Length:196 Species:Homo sapiens


Alignment Length:160 Identity:66/160 - (41%)
Similarity:87/160 - (54%) Gaps:20/160 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DFPMRTSRLLDQHFGQGLKRDDL-----------MSSVWNSRPTVLRSGYL--RPWHTNSLQKQE 67
            |.|: :|||||..||.....|||           :||.|   |..||||.:  .|..|.......
Human    23 DSPL-SSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAW---PGTLRSGMVPRGPTATARFGVPA 83

  Fly    68 SGST-LNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSD 131
            .|.| .....|.::|.::|..|.|.|:.||..|.:|.|.|||||||.|.|.||:.|:::.|||::
Human    84 EGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAE 148

  Fly   132 VNPDTVTSSLSSDGLLTIKAPMKALPPPQT 161
            |:|.||.:|||.:|||.|:||.  :||..|
Human   149 VDPVTVFASLSPEGLLIIEAPQ--VPPYST 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 39/82 (48%)
HSPB8NP_055180.1 ACD_HspB8_like 80..170 CDD:107235 40/89 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148938
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.