DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Cryab

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_037067.1 Gene:Cryab / 25420 RGDID:2414 Length:175 Species:Rattus norvegicus


Alignment Length:162 Identity:72/162 - (44%)
Similarity:97/162 - (59%) Gaps:22/162 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FPMRT-SRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRP--------WHTNSLQKQESGSTL 72
            ||..: |||.||.||:.|...||.|:.     |.|...||||        |....|      |.:
  Rat    15 FPFHSPSRLFDQFFGEHLLESDLFSTA-----TSLSPFYLRPPSFLRAPSWIDTGL------SEM 68

  Fly    73 NIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTV 137
            .::.::|.|.|||:.|||.|:.|||....:.|.|||||:|||||::||:|.|:|::|:||:|.|:
  Rat    69 RMEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTI 133

  Fly   138 TSSLSSDGLLTIKAPMKALPPPQTERLVQITQ 169
            ||||||||:||:..|.|....|  ||.:.||:
  Rat   134 TSSLSSDGVLTVNGPRKQASGP--ERTIPITR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 43/81 (53%)
CryabNP_037067.1 Crystallin 1..52 CDD:395419 18/41 (44%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 44/82 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..175 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342783
Domainoid 1 1.000 104 1.000 Domainoid score I6549
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68209
Inparanoid 1 1.050 125 1.000 Inparanoid score I4608
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm45870
orthoMCL 1 0.900 - - OOG6_101545
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X393
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.