powered by:
Protein Alignment l(2)efl and Odf1
DIOPT Version :9
Sequence 1: | NP_001261156.1 |
Gene: | l(2)efl / 37744 |
FlyBaseID: | FBgn0011296 |
Length: | 187 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017450148.1 |
Gene: | Odf1 / 24610 |
RGDID: | 3228 |
Length: | 256 |
Species: | Rattus norvegicus |
Alignment Length: | 75 |
Identity: | 21/75 - (28%) |
Similarity: | 37/75 - (49%) |
Gaps: | 7/75 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 LDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFS-----RRYQLPSDVNPDTVTSSLS 142
::|..|.|.::.|:|.|..|.|..:.|.:.|..| |:::| :.:.||..|:...||.|..
Rat 126 VNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLG--SKKYSYMNICKEFSLPPCVDEKDVTYSYG 188
Fly 143 SDGLLTIKAP 152
....:.|::|
Rat 189 LGSCVKIESP 198
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
l(2)efl | NP_001261156.1 |
metazoan_ACD |
71..153 |
CDD:107247 |
21/75 (28%) |
Odf1 | XP_017450148.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.