DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Odf1

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_017450148.1 Gene:Odf1 / 24610 RGDID:3228 Length:256 Species:Rattus norvegicus


Alignment Length:75 Identity:21/75 - (28%)
Similarity:37/75 - (49%) Gaps:7/75 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFS-----RRYQLPSDVNPDTVTSSLS 142
            ::|..|.|.::.|:|.|..|.|..:.|.:.|..|  |:::|     :.:.||..|:...||.|..
  Rat   126 VNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLG--SKKYSYMNICKEFSLPPCVDEKDVTYSYG 188

  Fly   143 SDGLLTIKAP 152
            ....:.|::|
  Rat   189 LGSCVKIESP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 21/75 (28%)
Odf1XP_017450148.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.