DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Hspb1

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_114176.4 Gene:Hspb1 / 24471 RGDID:61306 Length:206 Species:Rattus norvegicus


Alignment Length:202 Identity:71/202 - (35%)
Similarity:101/202 - (50%) Gaps:43/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FRDWWDELDFPMRTSRLLDQHFGQGLKRDD----LMSSVWNSRPTVLRSGYLRPW---------- 58
            ||||     :|.. |||.||.||.....|:    ..|:.|        .||:||.          
  Rat    19 FRDW-----YPAH-SRLFDQAFGVPRFPDEWSQWFSSAGW--------PGYVRPLPAATAEGPAA 69

  Fly    59 -------HTNSLQKQESG--STLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDE 114
                   .:.:|.:|.|.  |.:...::::.|.|||..|:|.|:|||..:..|.:.|||||:|||
  Rat    70 VTLAAPAFSRALNRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKEGVVEITGKHEERQDE 134

  Fly   115 HGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQITQT------GPS 173
            |||:||.|:|:|.||..|:|..|:||||.:|.||::||:........|..:.:|..      ||.
  Rat   135 HGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQSAEITIPVTFEARAQIGGPE 199

  Fly   174 SKEDNAK 180
            |::..||
  Rat   200 SEQSGAK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 40/81 (49%)
Hspb1NP_114176.4 Interaction with TGFB1I1. /evidence=ECO:0000269|PubMed:11546764 74..206 50/131 (38%)
ACD_HspB1_like 88..173 CDD:107230 41/84 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101545
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.