DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Hspb6

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001012401.1 Gene:Hspb6 / 243912 MGIID:2685325 Length:162 Species:Mus musculus


Alignment Length:141 Identity:59/141 - (41%)
Similarity:84/141 - (59%) Gaps:13/141 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESGSTLNIDSEKFEVILDVQQ 87
            ||.||.||:||...:|.|         |....:.|::..:.......:.::.||..|.|:|||:.
Mouse    27 RLFDQRFGEGLLEAELAS---------LCPAAIAPYYLRAPSVALPTAQVSTDSGYFSVLLDVKH 82

  Fly    88 FSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKA- 151
            |.|.||:|||.|..|.|..:|||:.||||:::|:|.|||:||..|:|..|||:||.:|:|:|:| 
Mouse    83 FLPEEISVKVVDDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAT 147

  Fly   152 PMKA---LPPP 159
            |..|   ||.|
Mouse   148 PASAQAQLPSP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 42/82 (51%)
Hspb6NP_001012401.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000250|UniProtKB:O14558 1..72 13/53 (25%)
Crystallin 5..56 CDD:278926 12/37 (32%)
ACD_HspB4-5-6 66..148 CDD:107233 42/81 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I4671
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm43786
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.