DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Cryaa

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001276666.1 Gene:Cryaa / 24273 RGDID:2413 Length:196 Species:Rattus norvegicus


Alignment Length:196 Identity:71/196 - (36%)
Similarity:104/196 - (53%) Gaps:29/196 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WWDELDFPMRTSRLLDQHFGQGLKRDDLMSSVWNS-RP--------TVLRSG----YLRPWHTNS 62
            |:.....|...|||.||.||:||...||:..:.:: .|        |||.||    ....|..  
  Rat     9 WFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISELMTHMWFV-- 71

  Fly    63 LQKQESGSTLN------IDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQ 121
            :.:..:|:..|      .|.:||.:.|||:.|||.::||||.:.||.:.|||.|:||:|||:||:
  Rat    72 MHQPHAGNPKNNPGKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISRE 136

  Fly   122 FSRRYQLPSDVNPDTVTSSLSSDGLLTIKAP--MKALPPPQTERLVQITQTGPSSKEDNAKKVET 184
            |.|||:|||:|:...::.|||:||:||...|  ...|....:||.:      |.|:|:......:
  Rat   137 FHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAI------PVSREEKPSSAPS 195

  Fly   185 S 185
            |
  Rat   196 S 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 43/89 (48%)
CryaaNP_001276666.1 Crystallin 1..51 CDD:395419 14/41 (34%)
alpha-crystallin-Hsps_p23-like 86..168 CDD:412199 41/81 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342789
Domainoid 1 1.000 104 1.000 Domainoid score I6549
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4608
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm45870
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.