DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Hspb6

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_620242.1 Gene:Hspb6 / 192245 RGDID:621554 Length:162 Species:Rattus norvegicus


Alignment Length:141 Identity:58/141 - (41%)
Similarity:82/141 - (58%) Gaps:13/141 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESGSTLNIDSEKFEVILDVQQ 87
            ||.||.||:||...:|.|         |....:.|::..:.......:.:..|...|.|:|||:.
  Rat    27 RLFDQRFGEGLLEAELAS---------LCPAAIAPYYLRAPSVALPTAQVPTDPGYFSVLLDVKH 82

  Fly    88 FSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKA- 151
            |||.||:|||....|.|..:|||:.||||:::|:|.|||:||..|:|..|||:||.:|:|:|:| 
  Rat    83 FSPEEISVKVVGDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAT 147

  Fly   152 PMKA---LPPP 159
            |..|   ||.|
  Rat   148 PASAQASLPSP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 41/82 (50%)
Hspb6NP_620242.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000250|UniProtKB:O14558 1..72 13/53 (25%)
Crystallin 3..58 CDD:395419 12/39 (31%)
ACD_HspB4-5-6 66..148 CDD:107233 41/81 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6549
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4608
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm45870
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X393
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.