DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and ZK1128.7

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_499252.2 Gene:ZK1128.7 / 191528 WormBaseID:WBGene00014233 Length:205 Species:Caenorhabditis elegans


Alignment Length:200 Identity:49/200 - (24%)
Similarity:78/200 - (39%) Gaps:60/200 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DDLMS----SVWNSRPTV----------LRSGYLRPWHTNSL--------------------QKQ 66
            |||.|    |||:.:|:.          :.|.:.|..|:|.:                    |..
 Worm     9 DDLDSYLEGSVWSEKPSASEIFSSKPGDVISVFPRSSHSNMIYGYPINYKETVFPTHRGPPDQSY 73

  Fly    67 ES-------------------GSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQ 112
            :|                   |...| .|..|.:.:||..|.|.||.|.:.|..:.:.|:..|..
 Worm    74 DSYYTKITESRPRSPGPVAGAGEITN-TSHGFTIEIDVFHFMPEEIKVVLTDDTLSISGERFEST 137

  Fly   113 DEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQITQTGPSSKED 177
            .:...:.|.|||:|.:|.||:.||:.|.|::.|:|.|....|..      |...|:...|:::.:
 Worm   138 GDGHTLRRSFSRKYSIPDDVHLDTIRSHLTNSGVLIINGSRKGW------RETSISSYHPTTQRN 196

  Fly   178 NAKKV 182
            .|:.|
 Worm   197 VARSV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 28/81 (35%)
ZK1128.7NP_499252.2 metazoan_ACD 96..178 CDD:107247 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.