Sequence 1: | NP_001261156.1 | Gene: | l(2)efl / 37744 | FlyBaseID: | FBgn0011296 | Length: | 187 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_499252.2 | Gene: | ZK1128.7 / 191528 | WormBaseID: | WBGene00014233 | Length: | 205 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 49/200 - (24%) |
---|---|---|---|
Similarity: | 78/200 - (39%) | Gaps: | 60/200 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 DDLMS----SVWNSRPTV----------LRSGYLRPWHTNSL--------------------QKQ 66
Fly 67 ES-------------------GSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQ 112
Fly 113 DEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQITQTGPSSKED 177
Fly 178 NAKKV 182 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(2)efl | NP_001261156.1 | metazoan_ACD | 71..153 | CDD:107247 | 28/81 (35%) |
ZK1128.7 | NP_499252.2 | metazoan_ACD | 96..178 | CDD:107247 | 28/82 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3591 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1187096at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45640 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X393 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.920 |