DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and F08H9.4

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_506586.1 Gene:F08H9.4 / 184215 WormBaseID:WBGene00008592 Length:147 Species:Caenorhabditis elegans


Alignment Length:124 Identity:39/124 - (31%)
Similarity:64/124 - (51%) Gaps:14/124 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KRDDLMSSVWNSRPTVLR-----SGYLRPWHTNSLQKQESGSTLNIDSEKFEVILDVQQFSPSEI 93
            |||..:..:......:.|     ||...|...:|       ..:| .::||.|.|:|..|.|.|:
 Worm    10 KRDSQLGEMMRDMGGMQRRLMPISGTFNPMTDDS-------EIMN-SNDKFAVNLNVSNFKPEEL 66

  Fly    94 TVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAP 152
            .|.:..:.:.::|:| :.::|||...:.|||...||.||:..:|.::||:||.|.|:||
 Worm    67 KVNLEGRQLSIQGEH-DVENEHGASRKSFSRMILLPEDVDITSVATNLSNDGKLCIEAP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 31/82 (38%)
F08H9.4NP_506586.1 metazoan_ACD 47..125 CDD:107247 31/80 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.