DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and F08H9.3

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_506585.1 Gene:F08H9.3 / 184214 WormBaseID:WBGene00008591 Length:147 Species:Caenorhabditis elegans


Alignment Length:76 Identity:23/76 - (30%)
Similarity:46/76 - (60%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSL 141
            |||.|.|:|....|.|:.:.:..:.:.::.:|:|.::::...::.:|:...||.||:...::|:|
 Worm    49 EKFSVNLNVPDVKPEELKINLEGRKLSIKAEHQEIENDNISTTQTYSKSIVLPEDVDVTHLSSNL 113

  Fly   142 SSDGLLTIKAP 152
            |.||.|.|:.|
 Worm   114 SEDGKLLIEVP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 23/76 (30%)
F08H9.3NP_506585.1 metazoan_ACD 43..125 CDD:107247 23/76 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160447
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101545
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.