DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and hsp-16.2

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001379929.1 Gene:hsp-16.2 / 178659 WormBaseID:WBGene00002016 Length:145 Species:Caenorhabditis elegans


Alignment Length:92 Identity:36/92 - (39%)
Similarity:55/92 - (59%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQ 127
            :...||...:|.| :||.:.|:|.||.|.::.:.:..:.:.::|:.|.|.| |||..:.|||...
 Worm    35 ISPSESSEIVNND-QKFAINLNVSQFKPEDLKINLDGRTLSIQGEQELKTD-HGYSKKSFSRVIL 97

  Fly   128 LPSDVNPDTVTSSLSSDGLLTIKAPMK 154
            ||.||:...|.|:||.||.|:|:||.|
 Worm    98 LPEDVDVGAVASNLSEDGKLSIEAPKK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 32/81 (40%)
hsp-16.2NP_001379929.1 metazoan_ACD 42..123 CDD:107247 32/82 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160441
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 1 0.950 - 0 Normalized mean entropy S4216
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.