DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and hsp-12.3

DIOPT Version :10

Sequence 1:NP_523827.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_501667.1 Gene:hsp-12.3 / 177777 WormBaseID:WBGene00002012 Length:109 Species:Caenorhabditis elegans


Alignment Length:78 Identity:28/78 - (35%)
Similarity:42/78 - (53%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSL 141
            :.|||.|:...|.|:||.||...:|:.:...|..|.|:.|.::|..:|.|:||...:|.|:.|.|
 Worm    31 DHFEVGLEAHNFLPNEIDVKNIGEFLEIHMAHTTKDDKFGSITRSITRCYRLPKGTDPATIKSKL 95

  Fly   142 SSDGLLTIKAPMK 154
            ...|:|.|....|
 Worm    96 DGSGILHISGNKK 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_523827.1 metazoan_ACD 71..153 CDD:107247 27/75 (36%)
hsp-12.3NP_501667.1 metazoan_ACD 30..107 CDD:107247 27/75 (36%)

Return to query results.
Submit another query.