DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and hsp-12.3

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_501667.1 Gene:hsp-12.3 / 177777 WormBaseID:WBGene00002012 Length:109 Species:Caenorhabditis elegans


Alignment Length:78 Identity:28/78 - (35%)
Similarity:42/78 - (53%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSL 141
            :.|||.|:...|.|:||.||...:|:.:...|..|.|:.|.::|..:|.|:||...:|.|:.|.|
 Worm    31 DHFEVGLEAHNFLPNEIDVKNIGEFLEIHMAHTTKDDKFGSITRSITRCYRLPKGTDPATIKSKL 95

  Fly   142 SSDGLLTIKAPMK 154
            ...|:|.|....|
 Worm    96 DGSGILHISGNKK 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 27/75 (36%)
hsp-12.3NP_501667.1 metazoan_ACD 30..107 CDD:107247 27/75 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14686
orthoMCL 1 0.900 - - OOG6_101545
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.