DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and sip-1

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_499316.1 Gene:sip-1 / 176471 WormBaseID:WBGene00004798 Length:159 Species:Caenorhabditis elegans


Alignment Length:158 Identity:52/158 - (32%)
Similarity:79/158 - (50%) Gaps:21/158 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GLKRD--DLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESGSTLNIDSEKFEVILDVQQFSPSEIT 94
            ||.||  |:| ..|..|.::|.       :.|::..|:.....| .::||.|.|||..|.|.|:.
 Worm    13 GLFRDFEDMM-PYWAQRHSMLN-------NFNNIVPQQLNEVEN-TAQKFCVKLDVAAFKPEELK 68

  Fly    95 VKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAP------- 152
            |.:....:.:||.||.| .|||:..|.|:|::.||.||:...:.:.::.:|.:||.||       
 Worm    69 VNLEGHVLTIEGHHEVK-TEHGFSKRSFTRQFTLPKDVDLAHIHTVINKEGQMTIDAPKTGSNTT 132

  Fly   153 MKALPPPQTERLVQITQTGPSSKEDNAK 180
            ::|| |..|.....:||. |||.....|
 Worm   133 VRAL-PIHTSAGHAVTQK-PSSTTTTGK 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 31/88 (35%)
sip-1NP_499316.1 IbpA <45..129 CDD:223149 31/85 (36%)
metazoan_ACD 45..126 CDD:107247 30/82 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.