DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and hsp-12.2

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_498776.1 Gene:hsp-12.2 / 176148 WormBaseID:WBGene00002011 Length:110 Species:Caenorhabditis elegans


Alignment Length:93 Identity:42/93 - (45%)
Similarity:61/93 - (65%) Gaps:0/93 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQ 127
            ||..:....::...|||||.||||.|:|.||.|||:.:.:::..:||.:.|.||.|:|:.:|.|:
 Worm    18 LQHNDGVVKVHNTKEKFEVGLDVQFFTPKEIEVKVSGQELLIHCRHETRSDNHGTVAREINRAYK 82

  Fly   128 LPSDVNPDTVTSSLSSDGLLTIKAPMKA 155
            ||.||:..||.|.|::.|:|||.|..||
 Worm    83 LPDDVDVSTVKSHLATRGVLTITASKKA 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 38/81 (47%)
hsp-12.2NP_498776.1 metazoan_ACD 26..108 CDD:107247 38/81 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160469
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4216
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14686
orthoMCL 1 0.900 - - OOG6_101545
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.