DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Hspb2

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_569115.1 Gene:Hspb2 / 161476 RGDID:70914 Length:182 Species:Rattus norvegicus


Alignment Length:167 Identity:57/167 - (34%)
Similarity:91/167 - (54%) Gaps:22/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESG-STLNIDSEKFEVILDV 85
            |||.:|.||:||..:::::      ||:....|:||....:.:...:| |.|.:...||:..|||
  Rat    22 SRLGEQRFGEGLLPEEILT------PTLYHGYYVRPRAARAGEGGRAGASELRLSEGKFQAFLDV 80

  Fly    86 QQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIK 150
            ..|:|.|:||:..|..:.|..:|.::.|.||:|||:|.|.|.||:||:|..|.::||.||:|.::
  Rat    81 SHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLE 145

  Fly   151 AP--------------MKALP-PPQTERLVQITQTGP 172
            ||              :..|| ||..|...::.:..|
  Rat   146 APRGGRHLDTEVNEVYISLLPAPPDPEEEEEVARVEP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 36/95 (38%)
Hspb2NP_569115.1 Crystallin <16..51 CDD:395419 11/34 (32%)
alpha-crystallin-Hsps_p23-like 67..148 CDD:412199 35/80 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342768
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.