DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and CRYAB

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001276736.1 Gene:CRYAB / 1410 HGNCID:2389 Length:175 Species:Homo sapiens


Alignment Length:162 Identity:71/162 - (43%)
Similarity:97/162 - (59%) Gaps:22/162 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FPMRT-SRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRP--------WHTNSLQKQESGSTL 72
            ||..: |||.||.||:.|...||..:     .|.|...||||        |....|      |.:
Human    15 FPFHSPSRLFDQFFGEHLLESDLFPT-----STSLSPFYLRPPSFLRAPSWFDTGL------SEM 68

  Fly    73 NIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTV 137
            .::.::|.|.|||:.|||.|:.|||....:.|.|||||:|||||::||:|.|:|::|:||:|.|:
Human    69 RLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTI 133

  Fly   138 TSSLSSDGLLTIKAPMKALPPPQTERLVQITQ 169
            ||||||||:||:..|.|.:..|  ||.:.||:
Human   134 TSSLSSDGVLTVNGPRKQVSGP--ERTIPITR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 43/81 (53%)
CRYABNP_001276736.1 Crystallin 1..52 CDD:395419 17/41 (41%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 44/82 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..175 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148908
Domainoid 1 1.000 105 1.000 Domainoid score I6645
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68209
Inparanoid 1 1.050 124 1.000 Inparanoid score I4724
Isobase 1 0.950 - 0 Normalized mean entropy S4216
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm41738
orthoMCL 1 0.900 - - OOG6_101545
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.880

Return to query results.
Submit another query.