DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Cryaa

DIOPT Version :10

Sequence 1:NP_523827.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001265498.1 Gene:Cryaa / 12954 MGIID:88515 Length:202 Species:Mus musculus


Alignment Length:203 Identity:71/203 - (34%)
Similarity:102/203 - (50%) Gaps:37/203 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WWDELDFPMRTSRLLDQHFGQGLKRDDLM------------SSVWNSRPTVLRSG----YLRPWH 59
            |:.....|...|||.||.||:||...||:            .|::.   |||.||    ....|.
Mouse     9 WFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFR---TVLDSGISELMTHMWF 70

  Fly    60 T----------NSLQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDE 114
            .          |:..|....:.:..|.:||.:.|||:.|||.::||||.:.||.:.|||.|:||:
Mouse    71 VMHQPHAGNPKNNPVKASYMAKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDD 135

  Fly   115 HGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAP--MKALPPPQTERLVQITQTGPSSKED 177
            |||:||:|.|||:|||:|:...::.|||:||:||...|  ...|....:||.:      |.|:|:
Mouse   136 HGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAI------PVSREE 194

  Fly   178 NAKKVETS 185
            ......:|
Mouse   195 KPSSAPSS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_523827.1 metazoan_ACD 71..153 CDD:107247 42/83 (51%)
CryaaNP_001265498.1 Crystallin 1..54 CDD:425732 14/44 (32%)
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 90..174 CDD:469641 41/83 (49%)

Return to query results.
Submit another query.