DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Cryaa

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001265498.1 Gene:Cryaa / 12954 MGIID:88515 Length:202 Species:Mus musculus


Alignment Length:203 Identity:71/203 - (34%)
Similarity:102/203 - (50%) Gaps:37/203 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WWDELDFPMRTSRLLDQHFGQGLKRDDLM------------SSVWNSRPTVLRSG----YLRPWH 59
            |:.....|...|||.||.||:||...||:            .|::.   |||.||    ....|.
Mouse     9 WFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFR---TVLDSGISELMTHMWF 70

  Fly    60 T----------NSLQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDE 114
            .          |:..|....:.:..|.:||.:.|||:.|||.::||||.:.||.:.|||.|:||:
Mouse    71 VMHQPHAGNPKNNPVKASYMAKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDD 135

  Fly   115 HGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAP--MKALPPPQTERLVQITQTGPSSKED 177
            |||:||:|.|||:|||:|:...::.|||:||:||...|  ...|....:||.:      |.|:|:
Mouse   136 HGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAI------PVSREE 194

  Fly   178 NAKKVETS 185
            ......:|
Mouse   195 KPSSAPSS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 42/83 (51%)
CryaaNP_001265498.1 Crystallin 1..50 CDD:278926 13/40 (33%)
alpha-crystallin-Hsps_p23-like 90..174 CDD:294116 41/83 (49%)
IbpA <93..174 CDD:223149 41/80 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838985
Domainoid 1 1.000 105 1.000 Domainoid score I6647
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I4671
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm43786
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.