DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and AgaP_AGAP007160

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_001688033.1 Gene:AgaP_AGAP007160 / 1269954 VectorBaseID:AGAP007160 Length:184 Species:Anopheles gambiae


Alignment Length:188 Identity:84/188 - (44%)
Similarity:121/188 - (64%) Gaps:11/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVVPLMFRDWWDELDFPMRTSRLLDQHFGQG-LKRDDLMSSVWNSRPTV-LR-SGYLRPWHTNS 62
            ||:||:.:|.|||:.|.|:.| |:|::...|. |..||    .|...|.. || |...|||...|
Mosquito     1 MSLVPVQYRTWWDDWDLPLYT-RVLEKSITQEVLGTDD----YWRGAPLAPLRWSSLYRPWRYFS 60

  Fly    63 LQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQ 127
            |  ::.|:.::.|.::|::.|||.||.|.|:||:..||:|.:|||||||:||.|||:|||||||.
Mosquito    61 L--RDVGAKVDTDRDRFQIELDVHQFLPHEVTVRRTDKYVTIEGKHEEKRDEQGYVARQFSRRYL 123

  Fly   128 LPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQITQTG-PSSKEDNAKKVET 184
            :|...:.:.:.|||||||:||:.||...||.|:.|:.|.|..|| |:.::.|:::..|
Mosquito   124 VPIGYDANLIVSSLSSDGVLTVTAPRIGLPAPKVEKYVPIWHTGKPAIEDKNSRRCLT 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 44/81 (54%)
AgaP_AGAP007160XP_001688033.1 metazoan_ACD 67..149 CDD:107247 44/81 (54%)
IbpA <69..163 CDD:223149 50/93 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100990at33392
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X393
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.