DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and HSPB6

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_653218.1 Gene:HSPB6 / 126393 HGNCID:26511 Length:160 Species:Homo sapiens


Alignment Length:152 Identity:62/152 - (40%)
Similarity:80/152 - (52%) Gaps:38/152 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLR--------------PWHTNSLQKQESGSTLN 73
            ||.||.||:||...:|.:..    ||.|...|||              |.|              
Human    27 RLFDQRFGEGLLEAELAALC----PTTLAPYYLRAPSVALPVAQVPTDPGH-------------- 73

  Fly    74 IDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVT 138
                 |.|:|||:.|||.||.|||..:.|.|..:|||:.||||:|:|:|.|||:||..|:|..||
Human    74 -----FSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVT 133

  Fly   139 SSLSSDGLLTIK-APMKALPPP 159
            |:||.:|:|:|: ||..|..||
Human   134 SALSPEGVLSIQAAPASAQAPP 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 41/82 (50%)
HSPB6NP_653218.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000269|PubMed:27717639 1..72 15/48 (31%)
Crystallin 3..58 CDD:395419 15/34 (44%)
ACD_HspB4-5-6 66..144 CDD:107233 41/96 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4724
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm41738
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.