DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Hspb8

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_446064.1 Gene:Hspb8 / 113906 RGDID:71003 Length:196 Species:Rattus norvegicus


Alignment Length:157 Identity:63/157 - (40%)
Similarity:87/157 - (55%) Gaps:20/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DFPMRTSRLLDQHFGQGLKRDDL-----------MSSVWNSRPTVLRSGYLRPWHTNSLQ---KQ 66
            |.|: :|||||..||.....|||           :||.|   |..||||.:....|.:.:   ..
  Rat    23 DSPL-SSRLLDDGFGMDPFPDDLTAPWPEWALPRLSSAW---PGTLRSGMVPRGPTATARFGVPA 83

  Fly    67 ESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSD 131
            |..:......|.::|.::|..|.|.|:.||..|.:|.|.|||||||.|.|.||:.|:::.|||::
  Rat    84 EGRNPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAE 148

  Fly   132 VNPDTVTSSLSSDGLLTIKAPMKALPP 158
            |:|.||.:|||.:|||.|:||.  :||
  Rat   149 VDPVTVFASLSPEGLLIIEAPQ--VPP 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 38/81 (47%)
Hspb8NP_446064.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 2/5 (40%)
ACD_HspB8_like 80..170 CDD:107235 39/89 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342807
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.