DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and CRYAA2

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001300979.1 Gene:CRYAA2 / 102724652 -ID:- Length:173 Species:Homo sapiens


Alignment Length:174 Identity:69/174 - (39%)
Similarity:101/174 - (58%) Gaps:19/174 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WWDELDFPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQKQ--ESG-STL 72
            |:.....|...|||.||.||:||...||:..:         |..:.|::..||.:.  :|| |.:
Human     9 WFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFL---------SSTISPYYRQSLFRTVLDSGISEV 64

  Fly    73 NIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTV 137
            ..|.:||.:.|||:.|||.::||||.|.||.:.|||.|:||:|||:||:|.|||:|||:|:...:
Human    65 RSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSAL 129

  Fly   138 TSSLSSDGLLTIKAP--MKALPPPQTERLVQITQ-----TGPSS 174
            :.|||:||:||...|  ...|.....||.:.:::     :.|||
Human   130 SCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 43/83 (52%)
CRYAA2NP_001300979.1 Crystallin 1..51 CDD:395419 15/50 (30%)
ACD_alphaA-crystallin_HspB4 60..145 CDD:107245 44/84 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148917
Domainoid 1 1.000 105 1.000 Domainoid score I6645
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4724
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm41738
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 1 1.000 - - X393
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.