DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and cryab

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_002932964.1 Gene:cryab / 100494321 XenbaseID:XB-GENE-971379 Length:173 Species:Xenopus tropicalis


Alignment Length:164 Identity:70/164 - (42%)
Similarity:96/164 - (58%) Gaps:15/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SRLLDQHFGQGLKRDDLM--SSVWNSRPTVLRSGYLR--PWHTNSLQKQESGSTLNIDSEKFEVI 82
            :|:.||:||:.|...:|.  |||   .|...|..:.|  .|..:.|      |.:.||.::|.|.
 Frog    21 NRIFDQNFGEHLHEAELFPTSSV---SPFFFRYPFSRLPNWIDSGL------SEMKIDKDRFSVN 76

  Fly    83 LDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLL 147
            |||:.|||.|:.|||...|:.:.|.|||:|||||||||.|.|||::||||:|.::||:||.||:|
 Frog    77 LDVKHFSPEELNVKVLGDFIEIHGTHEERQDEHGYVSRDFQRRYKIPSDVDPQSITSTLSPDGVL 141

  Fly   148 TIKAPMKALPPPQTERLVQITQTGPSSKEDNAKK 181
            |:..|.|....|  ||.:.||:....:.....||
 Frog   142 TVSGPRKVSEVP--ERCIPITREEKVAISSTLKK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 45/81 (56%)
cryabXP_002932964.1 Crystallin 1..51 CDD:366148 12/32 (38%)
alpha-crystallin-Hsps_p23-like 65..148 CDD:381838 46/82 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6425
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68209
Inparanoid 1 1.050 119 1.000 Inparanoid score I4632
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm48959
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.