DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and hspb6

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_002940672.2 Gene:hspb6 / 100494296 XenbaseID:XB-GENE-876273 Length:168 Species:Xenopus tropicalis


Alignment Length:155 Identity:66/155 - (42%)
Similarity:100/155 - (64%) Gaps:11/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSL-QKQESG-STLNIDSEKF 79
            ||   ||:|.|.||:|:...:|..::  ..|..|...|.|   :.|: |..|:| |.:.:|.::|
 Frog    20 FP---SRILGQRFGEGVLESELFPAM--PMPMALSPYYYR---SPSIPQPSEAGLSEVKLDKDQF 76

  Fly    80 EVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSD 144
            .|:|||:.|||.|:||||...:|.|..||||:.||||::||:|.|||::|..|:|..::|:||::
 Frog    77 SVLLDVKHFSPEELTVKVVGDYVEVHAKHEERPDEHGFISREFHRRYKIPPTVSPAAISSALSAE 141

  Fly   145 GLLTIKAPMKALPPPQTERLVQITQ 169
            |||:|:||:.| ...|.||.:.|.:
 Frog   142 GLLSIQAPVTA-GGKQEERSIPIAR 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 41/81 (51%)
hspb6XP_002940672.2 Crystallin 1..56 CDD:366148 14/43 (33%)
ACD_HspB4-5-6 68..149 CDD:107233 40/80 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6425
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4632
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm48959
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.