DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and LOC100491399

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_002939080.1 Gene:LOC100491399 / 100491399 -ID:- Length:208 Species:Xenopus tropicalis


Alignment Length:198 Identity:53/198 - (26%)
Similarity:84/198 - (42%) Gaps:46/198 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RDWWDELDFPM-RTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQK---QE-- 67
            ||.:.:|:..| ||...:...|       |||..                :|...||:   |:  
 Frog    27 RDVFSDLEQEMIRTVEKIKSSF-------DLMEQ----------------FHQKLLQEVTVQQNK 68

  Fly    68 -----SGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEK-QDEHG---YVSRQFS 123
                 :||......:.|.:.|.|:.|||.|:|||:..:.::|.|..|.| .|..|   |..:.|.
 Frog    69 TLPVLNGSDAKATDKGFTLCLGVEDFSPEELTVKLLGRKLLVTGAKESKCNDGKGSFSYKCQIFR 133

  Fly   124 RRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQITQTG-------PSSKEDNAKK 181
            :...||.:|..|.::.:::::|.|.|:|| :.|.|.:..|.|.|..||       .....:..|:
 Frog   134 KEADLPMNVREDKLSCTMTAEGKLLIEAP-EGLSPAEEGRNVPIQLTGSPAITQATEGSSEGIKE 197

  Fly   182 VET 184
            .||
 Frog   198 PET 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 26/85 (31%)
LOC100491399XP_002939080.1 alpha-crystallin-Hsps_p23-like 84..163 CDD:381838 27/79 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.