DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and hsp30d

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_002937646.1 Gene:hsp30d / 100489362 XenbaseID:XB-GENE-5917036 Length:215 Species:Xenopus tropicalis


Alignment Length:118 Identity:48/118 - (40%)
Similarity:64/118 - (54%) Gaps:18/118 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDE------HGYVSRQFSRRYQLPSDVNPD 135
            :.||:.|||:.|||.|:|||:..:.|||.||.|.|.|.      |.|  |::.|..:||..|||:
 Frog    94 DHFELTLDVRDFSPHELTVKMQGRRVIVTGKQERKSDSEDGSYFHEY--REWKREAELPEGVNPE 156

  Fly   136 TVTSSLSSDGLLTIKAPMKALPPPQTERLVQIT---------QTGPSSKEDNA 179
            .|..|.|.||.|.|:||..|| ||..||.:.|:         :..|.::..||
 Frog   157 QVVCSFSKDGHLHIQAPRLAL-PPAPERPIPISMDPAPRDAQEIPPDAQNSNA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 37/81 (46%)
hsp30dXP_002937646.1 ACD_HspB9_like 88..174 CDD:107236 37/81 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.