DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and cryaa

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_031752202.1 Gene:cryaa / 100488185 XenbaseID:XB-GENE-5940571 Length:115 Species:Xenopus tropicalis


Alignment Length:105 Identity:45/105 - (42%)
Similarity:73/105 - (69%) Gaps:4/105 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTS 139
            |.::|.:.|||:.|||.:::||:.|.||.:.|||.|:||:|||:||:|.|||:|||:|:.::|:.
 Frog    11 DRDRFFINLDVKHFSPEDLSVKLHDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQNSVSC 75

  Fly   140 SLSSDGLLTIKAPMKALPPPQTERLVQITQTGPSSKEDNA 179
            :||:||:|:...| |..|...:.   ...:|.|.|:|:.:
 Frog    76 TLSADGILSFSGP-KLQPNVDSS---HSDRTIPVSREEKS 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 38/77 (49%)
cryaaXP_031752202.1 alpha-crystallin-Hsps_p23-like 5..89 CDD:412199 39/78 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6425
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm48959
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.050

Return to query results.
Submit another query.