DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and hspb9

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001108177.1 Gene:hspb9 / 100137108 ZFINID:ZDB-GENE-080214-6 Length:204 Species:Danio rerio


Alignment Length:193 Identity:51/193 - (26%)
Similarity:88/193 - (45%) Gaps:32/193 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VPL-MFRDWWDELDFPMRTSRLLDQHFGQGLK---RDDLMSSVWNSRPTVL--RSGYLRPWHTNS 62
            :|| .||:     ||..|.::::     |.|:   ||.|::.:.......|  .|.:.|.:.|:.
Zfish    26 MPLSSFRE-----DFLHRRAQIM-----QNLRSEIRDSLLNELCEDFFQTLDGSSTFSRLFSTDP 80

  Fly    63 LQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVAD-KFVIVEGKHEEKQDEHGYV---SRQFS 123
            .||::...:|.         ||.:.|||.:::|.|:. :..::.||..||.......   :::|.
Zfish    81 EQKKKQDVSLT---------LDTRGFSPEDVSVTVSGRRLEVMAGKRAEKNASSSSAESQAQEFV 136

  Fly   124 RRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQI---TQTGPSSKEDNAKKVE 183
            :..|||..::|.::|.||..||||.|:.|.:.......|.:|.|   |.......:|.:.|.|
Zfish   137 QAVQLPDHLDPASLTCSLGEDGLLHIETPEETKDESSEEHVVPIRFRTSLDFPINKDRSNKTE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 25/85 (29%)
hspb9NP_001108177.1 IbpA 38..180 CDD:223149 40/155 (26%)
ACD_HspB9_like 79..166 CDD:107236 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582857
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.