DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and hspb3

DIOPT Version :10

Sequence 1:NP_523827.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_002941074.1 Gene:hspb3 / 100135387 XenbaseID:XB-GENE-969539 Length:145 Species:Xenopus tropicalis


Alignment Length:93 Identity:33/93 - (35%)
Similarity:60/93 - (64%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QKQESG--STLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRY 126
            :|:|.|  .....:.:||:|:|||.||.|.:|.::|.:.::|::|:|..:.||||::||.|:|.|
 Frog    46 KKREDGQLDDQQEEDDKFKVLLDVVQFRPEDIIIQVFEGWLIIKGEHGCRMDEHGFISRSFTRTY 110

  Fly   127 QLPSDVNPDTVTSSLSSDGLLTIKAPMK 154
            |||:.:....:::....||:|.::...|
 Frog   111 QLPNGIGLTDLSAFFCHDGILAVEGKQK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_523827.1 metazoan_ACD 71..153 CDD:107247 29/81 (36%)
hspb3XP_002941074.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 55..137 CDD:469641 29/81 (36%)

Return to query results.
Submit another query.