DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and cryaa

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_694482.1 Gene:cryaa / 100000769 ZFINID:ZDB-GENE-020508-1 Length:173 Species:Danio rerio


Alignment Length:173 Identity:69/173 - (39%)
Similarity:100/173 - (57%) Gaps:15/173 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LDFPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESG-STLNIDSEK 78
            |.:|   :||.||.||:||...||.....::.....|....|    |.|....|| |.:..|.||
Zfish    14 LGYP---TRLFDQFFGEGLFDYDLFPFTTSTVSPYYRHSLFR----NILDSSNSGVSEVRSDREK 71

  Fly    79 FEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSS 143
            |.|.|||:.|||.|::|||.|.:|.::|||.|:||:|||:||:|.|||:|||:|:...:|.:||:
Zfish    72 FTVYLDVKHFSPDELSVKVTDDYVEIQGKHGERQDDHGYISREFHRRYRLPSNVDQSAITCTLSA 136

  Fly   144 DGLLTIKAP-MKALPPPQTERLVQITQTGPSSKEDNAKKVETS 185
            |||||:..| ...:...:.:|.:.:|      :||.:....:|
Zfish   137 DGLLTLCGPKTSGIDAGRGDRTIPVT------REDKSNSGSSS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 45/82 (55%)
cryaaNP_694482.1 Crystallin 1..48 CDD:278926 12/36 (33%)
alpha-crystallin-Hsps_p23-like 61..146 CDD:294116 46/84 (55%)
IbpA <64..146 CDD:223149 44/81 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582886
Domainoid 1 1.000 102 1.000 Domainoid score I6798
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4775
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm26160
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 1 1.000 - - X393
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.