DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and SOT16

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_177550.1 Gene:SOT16 / 843750 AraportID:AT1G74100 Length:338 Species:Arabidopsis thaliana


Alignment Length:304 Identity:81/304 - (26%)
Similarity:133/304 - (43%) Gaps:30/304 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GNWEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDL 104
            |:|.|. |.|...|. ..|.   ||.|..|..:.:.||.||||::.|.:.::|...::.|.: .|
plant    49 GHWWQE-CLLEGLFH-AKDH---FEARPTDFLVCSYPKTGTTWLKALTYAIVNRSRYDDAAN-PL 107

  Fly   105 THRSPFLEFNGVVPNVPHD-----TIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNP 164
            ..|:|. ||   ||.|..|     |:.......:| |..:|:|..:||..|.:...|::|::|:|
plant   108 LKRNPH-EF---VPYVEIDFAFYPTVDVLQDRKNP-LFSTHIPNGLLPDSIVNSGCKMVYIWRDP 167

  Fly   165 KDAAIS---YFHHWRGMVGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHE--PNIFFTSYE 224
            ||..||   :.|..:...|...:..|....|..|...:.|...|:|.:|:...|  ..|.|..||
plant   168 KDTFISMWTFLHKEKSQEGQLASLEDSFDMFCKGLSVYGPYLDHVLGYWKAYQENPDRILFLRYE 232

  Fly   225 RMKGQLGQVISEVAQFLERSVSQEQ-----MQQMQRHLSFESMRDNPACNHVKEFESMKAAAGRE 284
            .|:......:..:|:|:....:.|:     .:::.:..|||::::..|....||.|...|.....
plant   233 TMRANPLPFVKRLAEFMGYGFTDEEEENGVAEKVVKLCSFETLKNLEANKGDKEREDRPAVYANS 297

  Fly   285 VEEFRFVRRGVVGSHKDELTADIIREFDLWSDSNLRDFKLNMDD 328
            .    :.|:|.||...:.||.::....|...:...:|..|...|
plant   298 A----YFRKGKVGDWANYLTPEMAARIDGLVEEKFKDTGLLQHD 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 68/269 (25%)
SOT16NP_177550.1 PLN02164 1..338 CDD:177822 81/304 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.