DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and SOT18

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_177549.1 Gene:SOT18 / 843749 AraportID:AT1G74090 Length:350 Species:Arabidopsis thaliana


Alignment Length:340 Identity:75/340 - (22%)
Similarity:133/340 - (39%) Gaps:68/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KSVPFEQIDKLAISGGYSSIFASS------KPSVPVV---GNWEQRFCRLADTFQPVLDRVYDFE 64
            :|..||:..|     .|..:.::.      :|..|::   |.|     .|....:..:.....|:
plant    26 ESTEFEKNQK-----RYQDLISTFPHEKGWRPKEPLIEYGGYW-----WLPSLLEGCIHAQEFFQ 80

  Fly    65 VRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAAAN 129
            .|..|..:.:.||.||||::.|.:.:.|...|:.:.       :|.|:.|      ||:.:....
plant    81 ARPSDFLVCSYPKTGTTWLKALTFAIANRSRFDDSS-------NPLLKRN------PHEFVPYIE 132

  Fly   130 A----LPSPRLIK--------SHLPAWMLPRQIWSKRPKIIYVYRNPKDAAIS---YFHHWRGMV 179
            .    .|...::|        :|:|..:||..:.....|::|::|.|||..||   :.|..|..:
plant   133 IDFPFFPEVDVLKDKGNTLFSTHIPYELLPDSVVKSGCKMVYIWREPKDTFISMWTFLHKERTEL 197

  Fly   180 GYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHE--PNIFFTSYERMKGQLGQVISEVAQFLE 242
            |......:....|..|...:.|...|||.:|:...|  ..|.|..||.|:......:..:|:|:.
plant   198 GPVSNLEESFDMFCRGLSGYGPYLNHILAYWKAYQENPDRILFLKYETMRADPLPYVKSLAEFMG 262

  Fly   243 RSVSQEQ-----MQQMQRHLSFESMRDNPACNHVKEFESMKAAAGRE-----VEEFRFVRRGVVG 297
            ...:.|:     ::::....|||::         |..|:.|....||     .....:.|:|.||
plant   263 HGFTAEEEEKGVVEKVVNLCSFETL---------KNLEANKGEKDREDRPGVYANSAYFRKGKVG 318

  Fly   298 SHKDELTADIIREFD 312
            ...:.||.::....|
plant   319 DWSNYLTPEMAARID 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 63/273 (23%)
SOT18NP_177549.1 PLN02164 18..350 CDD:177822 75/340 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.