DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and SOT7

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_174139.1 Gene:SOT7 / 839711 AraportID:AT1G28170 Length:326 Species:Arabidopsis thaliana


Alignment Length:295 Identity:82/295 - (27%)
Similarity:139/295 - (47%) Gaps:39/295 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFN-- 114
            |.|.||:....||.:|.|:.|.:.||.||||::.|...::     |.:|....:...|.|..|  
plant    47 TLQGVLNFQRGFEPQDTDIIIASFPKSGTTWLKALTVALL-----ERSKQKHSSDDHPLLLDNPH 106

  Fly   115 GVVP----------NVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRP-KIIYVYRNPKDAA 168
            |:||          :.|..|..::    ||||..:|: |:...|:.....| ||:||:||.||..
plant   107 GLVPFLELRLFTETSKPDLTSISS----SPRLFSTHV-AFQTLREALKNSPCKIVYVWRNVKDVL 166

  Fly   169 ISYFHHWRGMVGYQGTKS---DFMHSFIDGYVNFTPCWPHILDFWQ--LRHEPNIFFTSYERMKG 228
            :|:::.....:..:..:|   ....||..|.:|:.|.|.|:|::|:  |....|:.|..||.:|.
plant   167 VSFWYFNSAKLKIEEERSILDSMFESFCRGVINYGPSWEHVLNYWRASLEDSKNVLFLKYEELKT 231

  Fly   229 QLGQVISEVAQFLE--RSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAG-REVEEFRF 290
            :....:..:|:||:  .:|.:|:...::..|...|:|      ::|..|..|.... |..:...|
plant   232 EPRVQLKRLAEFLDCPFTVEEEERGSVEEILDLCSLR------NLKNLEINKTGKTLRGADHKIF 290

  Fly   291 VRRGVVGSHKDELTADIIREFDLWSDSNLR--DFK 323
            .|:|.||..|:.||.::.:..|:.::....  |.|
plant   291 FRKGEVGDSKNHLTPEMEKIIDMITEEKFEGSDLK 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 74/277 (27%)
SOT7NP_174139.1 Sulfotransfer_1 35..324 CDD:304426 80/292 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.