DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and SOT17

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_173294.1 Gene:SOT17 / 838440 AraportID:AT1G18590 Length:346 Species:Arabidopsis thaliana


Alignment Length:343 Identity:80/343 - (23%)
Similarity:148/343 - (43%) Gaps:70/343 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AKSVP--FEQIDKLAISGGYSSIFASS------KPSVPVV---GNWEQRFCRLADTFQPVLDRVY 61
            |.|.|  ||:..|     .|..|.|:.      :|..|.|   |:|         ..||:|:.:.
plant    19 ASSSPSEFEKNQK-----HYQEIIATLPHKDGWRPKDPFVEYGGHW---------WLQPLLEGLL 69

  Fly    62 D----FEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPH 122
            .    |:.|.:|.::.:.||.||||::.|.:.:.|...|:.:       .:|.|:.|      ||
plant    70 HAQKFFKARPNDFFVCSYPKTGTTWLKALTFAIANRSKFDVS-------TNPLLKRN------PH 121

  Fly   123 DTIAAANA----LPSPRLIK--------SHLPAWMLPRQIWSKRPKIIYVYRNPKDAAIS---YF 172
            :.:.....    .||..::|        :|:|..:||..:.....||:|::|:|||..:|   :.
plant   122 EFVPYIEIDFPFFPSVDVLKDEGNTLFSTHIPYDLLPESVVKSGCKIVYIWRDPKDTFVSMWTFA 186

  Fly   173 HHWRGMVGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPN---IFFTSYERMKGQLGQVI 234
            |..|...|...:..:....:..|...:.|...|:|.:|: .::.|   |.|..||.|:......:
plant   187 HKERSQQGPVVSIEEAFDKYCQGLSAYGPYLDHVLGYWK-AYQANPDQILFLKYETMRADPLPYV 250

  Fly   235 SEVAQFLERSVSQEQ-----MQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRG 294
            ..:|:|:....::|:     ::::.:..|||::::..|....|:.|...|......    :.|:|
plant   251 KRLAEFMGYGFTKEEEEGNVVEKVVKLCSFETLKNLEANKGEKDREDRPAVYANSA----YFRKG 311

  Fly   295 VVGSHKDELTADIIREFD 312
            .||..::.||.:::...|
plant   312 KVGDWQNYLTPEMVARID 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 61/269 (23%)
SOT17NP_173294.1 PLN02164 1..346 CDD:177822 80/343 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.