DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and AT5G43690

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_199182.1 Gene:AT5G43690 / 834389 AraportID:AT5G43690 Length:331 Species:Arabidopsis thaliana


Alignment Length:326 Identity:80/326 - (24%)
Similarity:140/326 - (42%) Gaps:58/326 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SVPVVGNWEQRFCRLA------DTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINE 93
            |:|...:...:.|:..      :|.|.|::...:|:.:|.|:.:.:.||.||||::.|:..::  
plant    26 SLPTYQDSHVKLCKYQGCWYYHNTLQAVINYQRNFQPQDTDIILASFPKSGTTWLKALSVAIV-- 88

  Fly    94 CDFETAKSV----DLTHRSPFLEFN--GVVPNVPHDTIAAAN-------ALPSPRLIKSHLPAWM 145
               |.:|..    .|||  |.|..|  |:||....|.....:       :..||||..:|:|...
plant    89 ---ERSKQPFDDDPLTH--PLLSDNPHGIVPFFEFDMYLKTSTPDLTKFSTSSPRLFSTHMPLHT 148

  Fly   146 LPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVG----YQGTKSDFMHSFIDGYVNFTPCWPHI 206
            ....:.....|::|:.||.||..||.: |:|....    .:.|......||..|...:.|.|.|.
plant   149 FKEGLKGSPCKVVYMCRNIKDVLISDW-HFRSKYSNNEVSRSTLESMFESFCGGVSFYGPFWDHA 212

  Fly   207 LDFWQ--LRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACN 269
            |.:|:  |.:..::.|..||.||.:....:..:|:||....::|:             .|:.:.:
plant   213 LSYWRGSLENPKHVLFMRYEEMKTEPCVQVKRLAEFLGFPFTKEE-------------EDSGSIS 264

  Fly   270 HVKEFESMKAAAGREVEEF----------RFVRRGVVGSHKDELTADIIREFDLWSDSNLR--DF 322
            .:.|..|:...:|.||.:.          .:.|:|.||..|:.||.::..:.|:..:..|:  |.
plant   265 KLLELCSLGNLSGLEVNKTGKTWMNYDYKSYFRKGEVGDWKNHLTPEMENKIDMIIEEKLKGSDL 329

  Fly   323 K 323
            |
plant   330 K 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 71/285 (25%)
AT5G43690NP_199182.1 Sulfotransfer_1 21..329 CDD:304426 78/323 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.