DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and ST2B

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_196317.2 Gene:ST2B / 830591 AraportID:AT5G07000 Length:347 Species:Arabidopsis thaliana


Alignment Length:329 Identity:80/329 - (24%)
Similarity:136/329 - (41%) Gaps:51/329 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GYSSIFASSKPSVPVVGNWEQRFCRL-------ADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTT 81
            |.|..|.....|:|.......|:..|       |...|.:......|:...|||.:.|:||.|||
plant    27 GLSYEFQEMLDSLPKERGRRNRYLYLFQGFRCQAKEIQAITSFQKHFQSLPDDVVLATIPKSGTT 91

  Fly    82 WMQELAWLVINECDFETAKSVDLTH---------RSPFLEF----NGVVPNVPHDTIAAANALPS 133
            |::.|.:.::....|:...|....|         ..||.|:    ||.||::        :.|.|
plant    92 WLKALTFTILTRHRFDPVSSSSSDHPLLTSNPHDLVPFFEYKLYANGNVPDL--------SGLAS 148

  Fly   134 PRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQGTKSDFMHSFIDGY-- 196
            ||...:|:|...|...:.:...|::|:.|||.|..||.:|:...:.. :...:..:....|.|  
plant   149 PRTFATHVPFGALKDSVENPSVKVVYLCRNPFDTFISMWHYINNITS-ESVSAVLLDEAFDLYCR 212

  Fly   197 ---VNFTPCWPHILDFWQ--LRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQ---- 252
               :.|.|.|.|:|.:|:  |:....:.|..||.:|..:...:.::|.||....::|:.|:    
plant   213 GLLIGFGPFWEHMLGYWRESLKRPEKVLFLKYEDLKEDIETNLKKLASFLGLPFTEEEEQKGVVK 277

  Fly   253 -MQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFV-RRGVVGSHKDELTADIIREFDLWS 315
             :....|||::         |:.|..|::...:..|.||: |:|.|....:.|:...:.......
plant   278 AIADLCSFENL---------KKLEVNKSSKLIQNYENRFLFRKGEVSDLVNYLSPSQVERLSALV 333

  Fly   316 DSNL 319
            |..|
plant   334 DDKL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 70/279 (25%)
ST2BNP_196317.2 Sulfotransfer_1 17..342 CDD:304426 80/329 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.