DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and AT3G45080

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_190094.1 Gene:AT3G45080 / 823643 AraportID:AT3G45080 Length:329 Species:Arabidopsis thaliana


Alignment Length:293 Identity:74/293 - (25%)
Similarity:131/293 - (44%) Gaps:44/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVP 118
            |.||:...:|:.:|.|:.:.:.|||||||::.|.:.::..     :|........|.|..|   |
plant    51 QGVLNFQKNFKPQDTDIIVASFPKCGTTWLKALTFALVRR-----SKHPSHDDHHPLLSDN---P 107

  Fly   119 NVPHDTIAAANAL-----------PSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYF 172
            :|...::.....|           .|.||..:|:|:..|...:.....||:|:.||.||..:||:
plant   108 HVLSPSLEMYLYLCSENPDLTKFSSSSRLFSTHMPSHTLQEGLKGSTCKIVYMSRNVKDTLVSYW 172

  Fly   173 HHW------RGMVGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQ-LRHEPN-IFFTSYERMKGQ 229
            |.:      ..::   .:..|....|..|...|.|.|.|:|.:|: ...:|| :.|..:|.||.:
plant   173 HFFCKKQTDDNII---SSVEDTFEMFCRGVNFFGPFWDHVLSYWRGSLEDPNHVLFMKFEEMKEE 234

  Fly   230 LGQVISEVAQFLERSVSQEQMQQ--MQRHLSFESMRDNPACNHVKEFESMKA----AAGREVEEF 288
            ..:.|..:|:||....::|:.:.  :...:...|:|      ::...|..|.    :.|||.:  
plant   235 PREQIKRLAEFLGCLFTKEEEESGLVDEIIDLCSLR------NLSSLEINKTGKLHSTGRENK-- 291

  Fly   289 RFVRRGVVGSHKDELTADIIREFDLWSDSNLRD 321
            .|.|:|.||..|:.||.::..:.|:.....|::
plant   292 TFFRKGEVGDWKNYLTPEMENKIDMIIQEKLQN 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 70/280 (25%)
AT3G45080NP_190094.1 Sulfotransfer_1 20..327 CDD:304426 74/293 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.