DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and AT3G45070

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001327291.1 Gene:AT3G45070 / 823642 AraportID:AT3G45070 Length:355 Species:Arabidopsis thaliana


Alignment Length:295 Identity:80/295 - (27%)
Similarity:133/295 - (45%) Gaps:43/295 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNG 115
            :..|.||:....|:.:|.|:.:.:.|||||||::.|.:.:::.   ....|.|..|  |.|..|.
plant    75 NVLQAVLNFQKSFKPQDTDIIVASFPKCGTTWLKALTFALLHR---SKQPSHDDDH--PLLSNNP 134

  Fly   116 --VVPNVPHDT-IAAANA-----LPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYF 172
              :||....|. :.:.|.     ..||||..:|:|:..|...:.....||:|:.||.||..:||:
plant   135 HVLVPYFEIDLYLRSENPDLTKFSSSPRLFSTHVPSHTLQEGLKGSTCKIVYISRNVKDTLVSYW 199

  Fly   173 HHWRGMVGYQGTK-----------SDFMHSFIDGYVNFTPCWPHILDFWQ-LRHEPN-IFFTSYE 224
            |.:        ||           .|....|..|...|.|.|.|:|.:|: ...:|| :.|..:|
plant   200 HFF--------TKKQTDEKIISSFEDTFEMFCRGVSIFGPFWDHVLSYWRGSLEDPNHVLFMKFE 256

  Fly   225 RMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAA---AGREVE 286
            .||.:....|.:.|:||....::|:    :...|.:.:.|..:..::...|..|..   :|||.:
plant   257 EMKAEPRDQIKKFAEFLGCPFTKEE----EESGSVDEIIDLCSLRNLSSLEINKTGKLNSGRENK 317

  Fly   287 EFRFVRRGVVGSHKDELTADIIREFDLWSDSNLRD 321
              .|.|:|.||..|:.||.::..:.|:.....|::
plant   318 --MFFRKGEVGDWKNYLTPEMENKIDMIIQEKLQN 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 76/279 (27%)
AT3G45070NP_001327291.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.