DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and AT2G27570

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_180325.1 Gene:AT2G27570 / 817303 AraportID:AT2G27570 Length:273 Species:Arabidopsis thaliana


Alignment Length:276 Identity:67/276 - (24%)
Similarity:116/276 - (42%) Gaps:66/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVP 118
            |.||:...:|:.:|.::.:.:.|||||||::.|.:.:::.     :|.....|..|.|.      
plant    51 QAVLNFQKNFKPQDTNIIVASFPKCGTTWLKALTFSLVHR-----SKHPSHDHHHPLLS------ 104

  Fly   119 NVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQG 183
            |.||...::     ||||..:|:|:..|...:.....|::|:.||.||...::            
plant   105 NNPHVLFSS-----SPRLFSTHMPSHTLQEVLKDSTCKVVYICRNMKDTLETF------------ 152

  Fly   184 TKSDFMHSFIDGYVNFTPCWPHILDFWQLR-HEPN-IFFTSYERMKGQLGQVISEVAQFLERSVS 246
                  .||..|...|.|.|..:|.:|:.. .:|| :.|..:|.||.:..:.|..:|:||     
plant   153 ------ESFCKGVNFFGPFWDQVLSYWRRSLEDPNHVLFMRFEEMKAEPHEQIKRLAEFL----- 206

  Fly   247 QEQMQQMQRHLSFESMRDNPACNHVKEFESM------KAAAGREVEEFRFVRRGVVGSHKDELTA 305
                             |:|.....|..:.:      |...||:.:  .|.|:|.||..|:.||.
plant   207 -----------------DSPLLRKKKRTDCLEINKTGKLCEGRDNK--TFFRKGEVGDWKNYLTP 252

  Fly   306 DIIREFDLWSDSNLRD 321
            ::..:.|:.....|::
plant   253 EMENKIDMIIQEKLQN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 63/263 (24%)
AT2G27570NP_180325.1 Sulfotransfer_1 20..271 CDD:304426 67/276 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.