DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and ST4A

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_179098.1 Gene:ST4A / 815981 AraportID:AT2G14920 Length:333 Species:Arabidopsis thaliana


Alignment Length:328 Identity:76/328 - (23%)
Similarity:144/328 - (43%) Gaps:54/328 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SSIFASSKP-SVPVVGN--------WEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTT 81
            :.|..||.| .:..:||        |...     |..|.:.:....|:.::.|:.:.:..|.|||
plant    21 TKILISSLPWEIDYLGNKLFNYEGYWYSE-----DILQSIPNIHTGFQPQETDIILASFYKSGTT 80

  Fly    82 WMQELAWLVINECDFETAKSVDLTHRSPFLEFN--GVVPNV----------PHDTIAAANALPSP 134
            |::.|.:.::     :.:|.....|:.|.|..|  .:|||:          |..|...:::..||
plant    81 WLKALTFALV-----QRSKHSLEDHQHPLLHHNPHEIVPNLELDLYLKSSKPDLTKFLSSSSSSP 140

  Fly   135 RLIKSHLPAWMLPRQIWSKRP--KIIYVYRNPKDAAIS--YFHHWRGMVGYQGTKSD------FM 189
            ||..:|:.  :.|.|:..|..  ||:||.||.||..:|  ||...:.:     |:::      ..
plant   141 RLFSTHMS--LDPLQVPLKENLCKIVYVCRNVKDVMVSVWYFRQSKKI-----TRAEDYSLEAIF 198

  Fly   190 HSFIDGYVNFTPCWPHILDFWQ--LRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQ 252
            .||.:|.....|.|.|.|.:|:  |....:..|..||.:|.:....:..:|:||:...::|:   
plant   199 ESFCNGVTLHGPFWDHALSYWRGSLEDPKHFLFMRYEDLKAEPRTQVKRLAEFLDCPFTKEE--- 260

  Fly   253 MQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFDLWSDS 317
             :...|.:.:.:..:.::::..|..|......|:...:.|:|.||..|..:|.:::.:.|:..:.
plant   261 -EDSGSVDKILELCSLSNLRSVEINKTRTSSRVDFKSYFRKGQVGDWKSYMTPEMVDKIDMIIEE 324

  Fly   318 NLR 320
            .|:
plant   325 KLK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 66/278 (24%)
ST4ANP_179098.1 Sulfotransfer_1 66..330 CDD:279075 66/278 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.