DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and SOT12

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_178471.1 Gene:SOT12 / 814903 AraportID:AT2G03760 Length:326 Species:Arabidopsis thaliana


Alignment Length:265 Identity:82/265 - (30%)
Similarity:136/265 - (51%) Gaps:30/265 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 FEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKS------VDLTH-RSPFLEFNGVVPNV 120
            ||.:|.|:.:||.||.||||::.|.:.::|...|..:.|      |...| ..||||  ||....
plant    61 FEAKDSDIILVTNPKSGTTWLKALVFALLNRHKFPVSSSGNHPLLVTNPHLLVPFLE--GVYYES 123

  Fly   121 PHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQGTK 185
            |....   ::||||||:.:|:....||..:.|...||:|..|||||..:|.:|..:.:...:  .
plant   124 PDFDF---SSLPSPRLMNTHISHLSLPESVKSSSCKIVYCCRNPKDMFVSLWHFGKKLAPEE--T 183

  Fly   186 SDF-----MHSFIDGYVNFTPCWPHILDFWQL-RHEPN-IFFTSYERMKGQLGQVISEVAQFLER 243
            :|:     :.:|.:|.....|.|.|||::|.. |..|| :.|.:||.:|.|....:..:|:|||.
plant   184 ADYPIEKAVEAFCEGKFIGGPFWDHILEYWYASRENPNKVLFVTYEELKKQTEVEMKRIAEFLEC 248

  Fly   244 S-VSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADI 307
            . :.:|:::::.:..||||:      ::::..:..|...|  :|...|.|:|.:|..:|.|:..:
plant   249 GFIEEEEVREIVKLCSFESL------SNLEVNKEGKLPNG--IETKTFFRKGEIGGWRDTLSESL 305

  Fly   308 IREFD 312
            ..|.|
plant   306 AEEID 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 80/261 (31%)
SOT12NP_178471.1 Sulfotransfer_3 23..322 CDD:419727 82/265 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 119 1.000 Domainoid score I1897
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D780670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm948
orthoMCL 1 0.900 - - OOG6_100094
Panther 1 1.100 - - O PTHR11783
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.