DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and LOC798316

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_021325257.1 Gene:LOC798316 / 798316 -ID:- Length:206 Species:Danio rerio


Alignment Length:225 Identity:49/225 - (21%)
Similarity:87/225 - (38%) Gaps:55/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LAWLVINECDFETAKSVDLTHR-SPF-----LEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAW 144
            :.|:...|      |..|.:.| |||     ..|.|           ||:|..||...||||   
Zfish     1 MPWIEYQE------KGKDYSTRPSPFSKTLLFTFTG-----------AADAQSSPEERKSHL--- 45

  Fly   145 MLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQGTKSDFMHSFIDGYVNFTPCWPHILDF 209
                           .:..|:.         |..|.:..:..:.:..||.|.:.....:.|:..:
Zfish    46 ---------------CHEEPQR---------RHGVVFSRSYDEMLKKFITGCMIGGSWFDHVKGW 86

  Fly   210 WQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEF 274
            ...:.:.||...:||.|...|..||.::.:|:.:::|...:.::....:|..|:.:|..|    :
Zfish    87 VTSKDKYNILILTYEEMIKDLRSVIVKICKFVGKNLSDAAIDKVVERATFNQMKVDPVAN----Y 147

  Fly   275 ESMKAAAGREVEEFRFVRRGVVGSHKDELT 304
            ||:......:.:.. |:|:|.||..::.||
Zfish   148 ESVPWKITDQPKGV-FLRKGTVGDWRNSLT 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 49/225 (22%)
LOC798316XP_021325257.1 Sulfotransfer_1 <63..195 CDD:307022 27/119 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.