DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and LOC779590

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001107699.1 Gene:LOC779590 / 779590 -ID:- Length:294 Species:Xenopus tropicalis


Alignment Length:290 Identity:91/290 - (31%)
Similarity:153/290 - (52%) Gaps:42/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VPVV----GNWEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDF 96
            :|:|    .||               ||:.:|:.||||:.|.|.||.||||:.|:..:|:::.|.
 Frog    18 IPMVAAFASNW---------------DRIDNFQARDDDLVICTYPKSGTTWISEIVDVVLSDGDT 67

  Fly    97 ETAKSVDLTHRSPFLEFN--GVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIY 159
            |.:|...:.::.|.:||:  |.||:    ......::||||:||:||...:||:..|.|:.|.||
 Frog    68 EKSKRDAIHNKVPMMEFSAPGYVPS----GSLVLESIPSPRIIKTHLSVSLLPKSFWEKKCKYIY 128

  Fly   160 VYRNPKDAAISYFHHWR--GMVGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTS 222
            |.|||||.|:|::|..|  .:....|....::..||:|.|.:.|..||:.|:|:||.:.|:.:..
 Frog   129 VARNPKDVAVSFYHFDRMNHLHPEPGPWDQYLEKFIEGKVAYGPWGPHVRDWWELRKKQNVLYLF 193

  Fly   223 YERMKGQLGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNH-----VKEFESMKAAAG 282
            ||.|.....:.|.:|..||.:.:.:..::::.:|.||::|::||..|:     :...:|:..   
 Frog   194 YEDMIEDPKREIRKVVSFLGKDLPETVVEKICQHTSFKAMKENPMTNYTSVPSIVMDQSISP--- 255

  Fly   283 REVEEFRFVRRGVVGSHKDELTADIIREFD 312
                   |:|:|:.|..|:..|......||
 Frog   256 -------FMRKGISGDWKNHFTVSQSEIFD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 83/255 (33%)
LOC779590NP_001107699.1 Sulfotransfer_1 38..289 CDD:395556 83/255 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H69169
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm9468
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.