DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult2a8

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001186235.1 Gene:Sult2a8 / 76971 MGIID:1924221 Length:282 Species:Mus musculus


Alignment Length:274 Identity:75/274 - (27%)
Similarity:130/274 - (47%) Gaps:24/274 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QPVLDRVYD-FEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVV 117
            |.::..|.| |.|||:|..|||.||.||.|:.|:..|::.:.|....:|.....|:|::||    
Mouse    20 QEIIREVRDRFVVRDEDTIIVTYPKSGTHWLNEIVCLILTKGDPTWVQSTIANERTPWIEF---- 80

  Fly   118 PNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMVGYQ 182
                .:.....|:...|||:.|.||..:.|:..:|.:.|:||:.|||:|..:|.:|::..:  .|
Mouse    81 ----ENNYRILNSKEGPRLMASLLPIQLFPKSFFSSKAKVIYLIRNPRDVLVSGYHYFNAL--KQ 139

  Fly   183 GTK----SDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLER 243
            |.:    ..:..:|:.|...|...:.|...:..||...||...|||::|......|.::.:||..
Mouse   140 GKEQVPWKIYFENFLQGKSYFGSWFEHACGWISLRKRENILVLSYEQLKKDTRNTIKKICEFLGE 204

  Fly   244 SVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADII 308
            ::...:::.:.:::||:.|::        ...|....:..|..|| .:|:|:.|..|:..|....
Mouse   205 NLESGELELVLKNISFQIMKE--------RMISQSCLSNIEKHEF-IMRKGITGDWKNHFTVAQA 260

  Fly   309 REFDLWSDSNLRDF 322
            ..||........||
Mouse   261 EAFDKAFQEKAADF 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 67/258 (26%)
Sult2a8NP_001186235.1 Sulfotransfer_1 34..275 CDD:366246 69/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847805
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.