DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult6b1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001157097.1 Gene:Sult6b1 / 73671 MGIID:1920921 Length:303 Species:Mus musculus


Alignment Length:257 Identity:77/257 - (29%)
Similarity:120/257 - (46%) Gaps:39/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNG 115
            :||: .||.   ||.|.|||.:.:.||||:.|:..    :::|..|..:|........|.||...
Mouse    43 ETFR-ALDA---FEARSDDVLLASYPKCGSNWILH----IVSELIFAVSKKKYACPEFPVLECGD 99

  Fly   116 VVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGM-- 178
            .      :........||||::.:||....||:.|:..:.||:.::|||||.|:|:||....:  
Mouse   100 A------EKYQRMKLFPSPRILTTHLHYDKLPQSIFKNKAKILVIFRNPKDTAVSFFHFHNDVPD 158

  Fly   179 VGYQGTKSDFMHSFIDGYVNFTPCWPHILDF---WQLRH--EPNIFFTSYERMKGQLGQVISEVA 238
            :....:..:|...||.|.|:    |....||   |. :|  :.|:.|..||.:|..|...|.:::
Mouse   159 IPSYASWDEFFRQFIKGQVS----WGSYFDFAINWN-KHIDDENVKFILYEDLKENLVVGIKQIS 218

  Fly   239 QFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHK 300
            :||..|::.||::.:....:|.:||.|....|        .|.|    .|.| |:|.||..|
Mouse   219 EFLGFSLTDEQIETISTQSTFLAMRANSQETH--------GAIG----PFLF-RKGEVGDWK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 70/241 (29%)
Sult6b1NP_001157097.1 Sulfotransfer_1 56..289 CDD:279075 70/240 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847783
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.