DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and sult6b1.3

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001164990.1 Gene:sult6b1.3 / 734046 XenbaseID:XB-GENE-22063270 Length:301 Species:Xenopus tropicalis


Alignment Length:269 Identity:79/269 - (29%)
Similarity:133/269 - (49%) Gaps:36/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 FEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAA 127
            ||.|:||:.:|:.|||||||...|    :|:. .:|..:.|..:....|||.  .||    ....
 Frog    51 FEAREDDLMLVSYPKCGTTWSLNL----LNDM-VQTVYNKDPPNMIQILEFG--APN----KYEK 104

  Fly   128 ANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHW--RGMVGYQGTKSDFMH 190
            .|..||||::.:||....:|:..::|:.|::.|:|||||.|:|:||.:  ..|:....:...|..
 Frog   105 LNEEPSPRVLGTHLHYDNIPQSFFNKKIKLLVVFRNPKDTAVSFFHFYNKNPMLPNYSSWDTFFE 169

  Fly   191 SFIDGYVNFTPCWPHILDF---WQLRH--EPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQM 250
            .||.|.|    ||....|.   |. :|  :.::...::|.||..|...:.::::|...|::.||:
 Frog   170 DFIGGKV----CWGSYFDHALAWN-KHIDDEDVLLMTFEEMKEDLEAAVKKLSKFCGFSMTDEQV 229

  Fly   251 QQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADIIREFDLWS 315
            |::.:..:|.:|::. ..|..|||..:            |:|:|.||..|:..:....:|.|...
 Frog   230 QEVAKKGTFTAMKEK-ISNIQKEFADI------------FLRKGEVGDWKNHFSEAQSQEIDAKF 281

  Fly   316 DSNLRDFKL 324
            ::.|...||
 Frog   282 EACLAGTKL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 74/261 (28%)
sult6b1.3NP_001164990.1 Sulfotransfer_1 55..288 CDD:366246 74/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.