DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and Sult1c2

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_081211.3 Gene:Sult1c2 / 69083 MGIID:1916333 Length:296 Species:Mus musculus


Alignment Length:281 Identity:86/281 - (30%)
Similarity:144/281 - (51%) Gaps:31/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PVVGNWEQRFCRLADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKS 101
            |.|.||.|               :..||.:.||:.|.|.||.||||:||:..::....|.|..:.
Mouse    24 PTVDNWRQ---------------IQTFEAKPDDLLICTYPKSGTTWIQEIVDMIEQNGDVEKCRR 73

  Fly   102 VDLTHRSPFLEFNGVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKD 166
            ..:.||.||:|:  ..|..| ..:..||.:|:||::::|||..:||...|:...|.:||.||.||
Mouse    74 TIIQHRHPFIEW--ARPPQP-SGVDKANEMPAPRILRTHLPTQLLPPSFWTNNCKFLYVARNAKD 135

  Fly   167 AAISYFHHWR--GMVGYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQ 229
            ..:||:|.:|  .::...||..::..:||:|.|::...:.|:..:|::|.:..|.|..||.||..
Mouse   136 CMVSYYHFYRMSQVLPEPGTWDEYFETFINGKVSWGSWFDHVKGWWEIRDKYQILFLFYEDMKRN 200

  Fly   230 LGQVISEVAQFLERSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEE---FRFV 291
            ....|.:|.||:.:::.::.:.::....|||.|::||..|        ::.|.:.:.:   ..|:
Mouse   201 PKHEIQKVMQFMGKNLDEDVVDKIVLETSFEKMKENPMTN--------RSTAPKSILDQSISPFM 257

  Fly   292 RRGVVGSHKDELTADIIREFD 312
            |:|.||..|:..|......||
Mouse   258 RKGTVGDWKNHFTVAQNERFD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 79/251 (31%)
Sult1c2NP_081211.3 Sulfotransfer_1 39..288 CDD:279075 79/251 (31%)
Substrate binding. /evidence=ECO:0000250 107..109 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847792
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - otm44260
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.660

Return to query results.
Submit another query.