DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and SULT2A1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_003158.2 Gene:SULT2A1 / 6822 HGNCID:11458 Length:285 Species:Homo sapiens


Alignment Length:274 Identity:81/274 - (29%)
Similarity:141/274 - (51%) Gaps:19/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ADTFQPVLDRVYDFEVRDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFN 114
            ::|.:.|.|   :|.:||:||.|:|.||.||.|:.|:..|:.::.|.:..:||.:..|||::|  
Human    20 SETLRKVRD---EFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVE-- 79

  Fly   115 GVVPNVPHDTIAAANALPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGMV 179
                  ......|.:...||||..||||..:.|:..:|.:.|:||:.|||:|..:|.:..|:.|.
Human    80 ------SEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMK 138

  Fly   180 GYQGTKS--DFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLE 242
            ..:..||  ::...|..|.|.:...:.||..:..:|.|.|....|||.:|...|:.|.::.|||.
Human   139 FIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLG 203

  Fly   243 RSVSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADI 307
            :::..|::..:.::.||:||::|...|:      ...:....|::.:.:|:||.|..|:..|...
Human   204 KTLEPEELNLILKNSSFQSMKENKMSNY------SLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQ 262

  Fly   308 IREFDLWSDSNLRD 321
            ..:||......:.|
Human   263 AEDFDKLFQEKMAD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 76/257 (30%)
SULT2A1NP_003158.2 Sulfotransfer_1 34..278 CDD:395556 76/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157405
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.