DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and SULT2B1

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_814444.1 Gene:SULT2B1 / 6820 HGNCID:11459 Length:365 Species:Homo sapiens


Alignment Length:319 Identity:92/319 - (28%)
Similarity:147/319 - (46%) Gaps:58/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPQSSFFAKSVPFEQIDKLAISGGYSSIFASSKPSVPVVGNWEQRFCRLADTFQPVLDRVYDFEV 65
            :|...|..|.|||.                        ||.:......||:..|         :|
Human    27 LPGEYFRYKGVPFP------------------------VGLYSLESISLAENTQ---------DV 58

  Fly    66 RDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDTIAAANA 130
            ||||::|:|.||.|||||.|:..|::.|.|....:||.:..|:|:.|           ||..|.:
Human    59 RDDDIFIITYPKSGTTWMIEIICLILKEGDPSWIRSVPIWERAPWCE-----------TIVGAFS 112

  Fly   131 LP---SPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWR--GMVGYQGTKSDFMH 190
            ||   ||||:.||||..:..:..:|.:.|:||:.|||:|..:|.:|:.:  |.:...||...|:.
Human   113 LPDQYSPRLMSSHLPIQIFTKAFFSSKAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLR 177

  Fly   191 SFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQEQMQQMQR 255
            .|:.|.|.|...:.||..:.:::.:.|..|.:||.::..|...:..:..||.|.:.:|.:..:..
Human   178 DFLKGEVQFGSWFDHIKGWLRMKGKDNFLFITYEELQQDLQGSVERICGFLGRPLGKEALGSVVA 242

  Fly   256 HLSFESMRDNPACNHVKEFESMKAAAGREVEEFR--FVRRGVVGSHKDELTADIIREFD 312
            |.:|.:|:.|...|:.....|:       ::..|  |:|:||.|..|:..|......||
Human   243 HSTFSAMKANTMSNYTLLPPSL-------LDHRRGAFLRKGVCGDWKNHFTVAQSEAFD 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 79/253 (31%)
SULT2B1NP_814444.1 Sulfotransfer_1 60..305 CDD:366246 79/253 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..365
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157414
Domainoid 1 1.000 149 1.000 Domainoid score I4409
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I4327
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.