DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment St1 and SULT1C2

DIOPT Version :9

Sequence 1:NP_611815.3 Gene:St1 / 37742 FlyBaseID:FBgn0034887 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_789795.1 Gene:SULT1C2 / 6819 HGNCID:11456 Length:307 Species:Homo sapiens


Alignment Length:331 Identity:86/331 - (25%)
Similarity:145/331 - (43%) Gaps:61/331 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPQSSFFAKSVPFEQIDKLAISGGYSSIFASSKPSVPVVGNWEQRFCRLADTFQPVLDRVYDFEV 65
            |..:|...|.:..::::...:           :|:  .|.||.|               :..||.
Human     1 MALTSDLGKQIKLKEVEGTLL-----------QPA--TVDNWSQ---------------IQSFEA 37

  Fly    66 RDDDVWIVTLPKCGTTWMQELAWLVINECDFETAKSVDLTHRSPFLEFNGVVPNVPHDT----IA 126
            :.||:.|.|.||.||||:||:..::....|.|..:...:.||.||:|:  ..|..|.:|    :|
Human    38 KPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEW--ARPPQPSETGFHHVA 100

  Fly   127 AANALPSPRLIKSHLP----------AWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWR--GMV 179
            .|..    :|:.|..|          ..:||...|....|.:||.||.||..:||:|..|  .|:
Human   101 QAGL----KLLSSSNPPASTSQSAKITDLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHML 161

  Fly   180 GYQGTKSDFMHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERS 244
            ...||..::..:||:|.|.:...:.|:..:|:::....|.|..||.:|......|.:|.||:.:.
Human   162 PDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKK 226

  Fly   245 VSQEQMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEE---FRFVRRGVVGSHKDELTAD 306
            |.:..:.::.:..|||.|::||..|        ::...:.:.:   ..|:|:|.||..|:..|..
Human   227 VDETVLDKIVQETSFEKMKENPMTN--------RSTVSKSILDQSISSFMRKGTVGDWKNHFTVA 283

  Fly   307 IIREFD 312
            ....||
Human   284 QNERFD 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
St1NP_611815.3 Sulfotransfer_1 67..322 CDD:279075 76/265 (29%)
SULT1C2NP_789795.1 Sulfotransfer_1 39..299 CDD:279075 76/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157393
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49491
OrthoDB 1 1.010 - - D481448at33208
OrthoFinder 1 1.000 - - FOG0000045
OrthoInspector 1 1.000 - - mtm8574
orthoMCL 1 0.900 - - OOG6_100094
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X38
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.660

Return to query results.
Submit another query.